PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00113462001
Common NameGSBRNA2T00113462001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 243aa    MW: 25464 Da    PI: 7.7546
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00113462001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.11.9e-382989262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         ++++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rk  k+s
  GSBRNA2T00113462001 29 QQEQLPCPRCDSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGTRKAAKRS 89
                         68999***************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31487IPR003851Zinc finger, Dof-type
PfamPF027013.2E-333187IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0033387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MTTSDSGESR RTAMRPHGGI TGLPPATEQQ EQLPCPRCDS TNTKFCYYNN YNFSQPRHFC  60
KSCRRYWTHG GTLRDIPVGG GTRKAAKRSR TCSSSAGVLN APLQATPVLF PQTSLSNGVC  120
HAVTENDGKG SSLSLCGSFT SLLNQNGNAE SATTHGTGGF GSGLGSGFDD VSFGLGRAAW  180
PFSTVDDAAT TNVGSNGGHH AVQIPATWQF EGLESSNAGG FVPGEYFAWP DLSITTPVSS  240
LK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00113462001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2255864e-97AY225586.1 Brassica rapa subsp. oleifera HRa (HRa), HRb (HRb), and HRc (HRc) genes, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009136544.11e-165PREDICTED: dof zinc finger protein DOF3.4-like
SwissprotQ390881e-119DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLA0A078ELM81e-180A0A078ELM8_BRANA; BnaA03g40810D protein
STRINGBra012901.1-P1e-165(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.11e-114OBF binding protein 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]